HPA012890

SPX antibody from Sigma-Aldrich
C12orf39, MGC10946, NPQ, spexin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012890
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012890, RRID:AB_1845537
Product name
Anti-C12orf39 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012890
Antibody type
Polyclonal
Antigen
Spexin Precursor recombinant protein epitope signature tag (PrEST
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
APQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRK
DLSDRPLPERRSPNPQLLTIPEAATILLASLQKSP
EDEEKNFDQTRFLEDSLLNW
Storage
-20C
Provider Type Product Number
- No reagents -