Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051804-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051804-M07, RRID:AB_566186
- Product name
- SIX4 monoclonal antibody (M07), clone 5E1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SIX4.
- Antigen sequence
GQDLLSVPMTQAALGEIVPTAEDQVGHPSPAVHQD
FVQEHRLVLQSVANMKENFLSNSESKATSSLMMLD
SKSKYVLDGMVDTVCEDLETDKKELAKLQTVQLDE
DMQD- Isotype
- IgG
- Antibody clone number
- 5E1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Specificity and prognostic validation of a polyclonal antibody to detect Six1 homeoprotein in ovarian cancer.
Qamar L, Deitsch E, Patrick AN, Post MD, Spillman MA, Iwanaga R, Thorburn A, Ford HL, Behbakht K
Gynecologic oncology 2012 May;125(2):451-7
Gynecologic oncology 2012 May;125(2):451-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SIX4 monoclonal antibody (M07), clone 5E1 Western Blot analysis of SIX4 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SIX4 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SIX4 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol