HPA012891

DSC1 antibody from Sigma-Aldrich
CDHF1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012891
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012891, RRID:AB_1847617
Product name
Anti-DSC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012891
Antibody type
Polyclonal
Antigen
Desmocollin-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAV
LKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGK
TAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTV
RVCDCSTPSECRMKDKSTR
Storage
-20C
Provider Type Product Number
- No reagents -