Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA035645 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA035645, RRID:AB_10600700
- Product name
- Anti-COL4A3BP
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GEAITFKATTAGILATLSHCIELMVKREDSWQKRL
DKETEKKRRTEEAYKNAMTELKKKSHFGGPDYEEG
PNSLINEEEFFDAVEAALD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The conformational plasticity of structurally unrelated lipid transport proteins correlates with their mode of action
Cholesterol-dependent homeostatic regulation of very long chain sphingolipid synthesis
Haeusler R, Srinivasan S, Di Luca A, Álvarez D, John Peter A, Gehin C, Lone M, Hornemann T, D’Angelo G, Vanni S
PLOS Biology 2024;22(8):e3002737
PLOS Biology 2024;22(8):e3002737
Cholesterol-dependent homeostatic regulation of very long chain sphingolipid synthesis
Kim Y, Mavodza G, Senkal C, Burd C
Journal of Cell Biology 2023;222(12)
Journal of Cell Biology 2023;222(12)
No comments: Submit comment
No validations: Submit validation data