H00092597-M07

MOB1B antibody from Abnova Corporation
MOB4A, MOBKL1A

Antibody data

Product number
H00092597-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00092597-M07, RRID:AB_1577386
Product name
MOBKL1A monoclonal antibody (M07), clone 2F8
Provider product page
Abnova Corporation - H00092597-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MOBKL1A.
Antigen sequence
TWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKR
LFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFF
VQEFNLIDRRELAPLQELIEKLTSKDR
Isotype
IgG
Antibody clone number
2F8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -