HPA000845

MCM5 antibody from Sigma-Aldrich
CDC46
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000845
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000845, RRID:AB_1079338
Product name
Anti-MCM5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000845
Antibody type
Polyclonal
Antigen
DNA replication licensing factor MCM5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVR
IAEALSKMKLQPFATEADVEEALRLFQVSTLDAAL
SGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQ
VSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGEIQH
RMQRKVLY
Storage
-20C
Provider Type Product Number
- No reagents -