HPA008960

TMED7 antibody from Atlas Antibodies
CGI-109, FLJ90481, p24g3, p24gamma3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008960
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008960, RRID:AB_1080280
Product name
Anti-TMED7
Provider product page
Atlas Antibodies - HPA008960
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHY
DVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTY
KFCFSNEFSTF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -