HPA008960

TMED7 antibody from Sigma-Aldrich
CGI-109, FLJ90481, p24g3, p24gamma3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008960
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008960, RRID:AB_1080280
Product name
Anti-TICAM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008960
Antibody type
Polyclonal
Antigen
Transmembrane emp24 domain-containing protein 7 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHY
DVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTY
KFCFSNEFSTF
Storage
-20C
Provider Type Product Number
- No reagents -