HPA010575

CHIT1 antibody from Sigma-Aldrich
CHI3, CHIT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010575
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010575, RRID:AB_1078512
Product name
Anti-CHIT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010575
Antibody type
Polyclonal
Antigen
Chitotriosidase-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGF
SCNQGRYPLIQTLRQELSLPYLPSGTPELEVPKPG
QPSEPEHGPSPGQDTFCQGKADGLYPNPRERSSFY
SCAAGRLFQQSCPTGLVFSNSCKCCTWN
Storage
-20C
Provider Type Product Number
- No reagents -