Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00124404-B01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00124404-B01P, RRID:AB_1579972
- Product name
- SEPT12 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human SEPT12 protein.
- Antigen sequence
MDPLRRSPSPCLSSQPSSPSTPPCEMLGPVGIEAV
LDQLKIKAMKMGFEFNIMVVGQSGLGKSTMVNTLF
KSKVWKSNPPGLGVPTPQTLQLHSLTHVIEEKGVK
LKLTVTDTPGFGDQINNDNCWDPILGYINEQYEQY
LQEEILITRQRHIPDTRVHCCVYFVPPTGHCLRPL
DIEFLQRLCRTVNVVPVIARADSLTMEEREAFRRR
IQQNLRTHCIDVYPQMCFDEDINDKILNSKLRDRI
PFAVVGADQEHLVNGRCVLGRKTKWGIIEVENMAH
CEFPLLRDLLIRSHLQDLKDITHNIHYENYRVIRL
NESHLLPRGPGWVNLAPASPGQLTTPRTFKVCRGA
HDDSDDEF- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references SEPT12-microtubule complexes are required for sperm head and tail formation.
SEPTIN12 genetic variants confer susceptibility to teratozoospermia.
SEPT12 mutations cause male infertility with defective sperm annulus.
Kuo PL, Chiang HS, Wang YY, Kuo YC, Chen MF, Yu IS, Teng YN, Lin SW, Lin YH
International journal of molecular sciences 2013 Nov 7;14(11):22102-16
International journal of molecular sciences 2013 Nov 7;14(11):22102-16
SEPTIN12 genetic variants confer susceptibility to teratozoospermia.
Lin YH, Wang YY, Chen HI, Kuo YC, Chiou YW, Lin HH, Wu CM, Hsu CC, Chiang HS, Kuo PL
PloS one 2012;7(3):e34011
PloS one 2012;7(3):e34011
SEPT12 mutations cause male infertility with defective sperm annulus.
Kuo YC, Lin YH, Chen HI, Wang YY, Chiou YW, Lin HH, Pan HA, Wu CM, Su SM, Hsu CC, Kuo PL
Human mutation 2012 Apr;33(4):710-9
Human mutation 2012 Apr;33(4):710-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SEPT12 expression in transfected 293T cell line (H00124404-T01) by SEPT12 MaxPab polyclonal antibody.Lane 1: SEPT12 transfected lysate(39.38 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to SEPT12 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of purified MaxPab antibody to SEPT12 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol