AV46474

PLAAT4 antibody from Sigma-Aldrich
HRASLS4, PLAAT-4, RARRES3, RIG1, TIG3
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV46474
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV46474, RRID:AB_1856081
Product name
Anti-RARRES3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV46474
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human RARRES3 with an internal ID of S18604
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
GYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRGRL
EDVVGGCCYRVNNSL
Storage
-20C
Provider Type Product Number
- No reagents -