H00011278-M04

KLF12 antibody from Abnova Corporation
AP-2rep, AP2REP, HSPC122

Antibody data

Product number
H00011278-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011278-M04, RRID:AB_1576658
Product name
KLF12 monoclonal antibody (M04), clone 3D2
Provider product page
Abnova Corporation - H00011278-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant KLF12.
Antigen sequence
MNIHMKRKTIKNINTFENRMLMLDGMPAVRVKTEL
LESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSL
SVDHFQTQTEPVDLSINKAR
Isotype
IgG
Antibody clone number
3D2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -