Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00022987-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00022987-M01, RRID:AB_1137484
- Product name
- SV2C monoclonal antibody (M01), clone 3D8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SV2C.
- Antigen sequence
EDSYKDRTSLMKGAKDIAREVKKQTVKKVNQAVDR
AQDEYTQRSYSRFQDEEDDDDYYPAGETYNGEAND
DEGSSEATEGHDEDDEIYEGEYQGIPSMNQ- Isotype
- IgG
- Antibody clone number
- 3D8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Expression pattern of synaptic vesicle protein 2 (SV2) isoforms in patients with temporal lobe epilepsy and hippocampal sclerosis.
Crèvecoeur J, Kaminski RM, Rogister B, Foerch P, Vandenplas C, Neveux M, Mazzuferi M, Kroonen J, Poulet C, Martin D, Sadzot B, Rikir E, Klitgaard H, Moonen G, Deprez M
Neuropathology and applied neurobiology 2014 Feb;40(2):191-204
Neuropathology and applied neurobiology 2014 Feb;40(2):191-204
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SV2C is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol