HPA012893

LRRCC1 antibody from Sigma-Aldrich
CLERC, KIAA1764, VFL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012893
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012893, RRID:AB_1852434
Product name
Anti-LRRCC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012893
Antibody type
Polyclonal
Antigen
Leucine-rich repeat and coiled-coil domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EYQEKIDVLSQQYMDLENEFRIALTVEARRFQDVK
DGFENVATELAKSKHALIWAQRKENESSSLIKDLT
CMVKEQKTKLAEVSKLKQETAANLQNQINTL
Storage
-20C
Provider Type Product Number
- No reagents -