HPA010027

IER3IP1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010027
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010027, RRID:AB_1079098
Product name
Anti-IER3IP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010027
Antibody type
Polyclonal
Antigen
Immediate early response 3-interacting protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLM
NLIRSVRT
Storage
-20C
Provider Type Product Number
- No reagents -