HPA010029

EMC7 antibody from Atlas Antibodies
C11orf3, C15orf24
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010029
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010029, RRID:AB_889052
Product name
Anti-EMC7
Provider product page
Atlas Antibodies - HPA010029
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSS
GKSSSGSSKTGKSGAGK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -