HPA010029

EMC7 antibody from Sigma-Aldrich
C11orf3, C15orf24
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010029
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010029, RRID:AB_1078335
Product name
Anti-C15orf24 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010029
Antibody type
Polyclonal
Antigen
Uncharacterized protein C15orf24 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSS
GKSSSGSSKTGKSGAGK
Storage
-20C
Provider Type Product Number
- No reagents -