Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA043109 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-SEMA6D
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DCHEILPTSTTPDYKIFGGPTSDMEVSSSSVTTMA
SIPEITPKVIDTWRPKLTSSRKFVVQDDPNTSDFT
DPLSGIPKGVRWEVQ- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A Sleeping Beauty forward genetic screen identifies new genes and pathways driving osteosarcoma development and metastasis
Moriarity B, Otto G, Rahrmann E, Rathe S, Wolf N, Weg M, Manlove L, LaRue R, Temiz N, Molyneux S, Choi K, Holly K, Sarver A, Scott M, Forster C, Modiano J, Khanna C, Hewitt S, Khokha R, Yang Y, Gorlick R, Dyer M, Largaespada D
Nature Genetics 2015;47(6):615-624
Nature Genetics 2015;47(6):615-624
No comments: Submit comment
No validations: Submit validation data