Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406054 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Sema Domain, Transmembrane Domain (TM), and Cytoplasmic Domain, (Semaphorin) 6D (SEMA6D) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SEMA6D antibody: synthetic peptide directed towards the N terminal of human SEMA6D
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
KLYSATVADFLASDAVIYRSMGDGSALRTIKYDSK
WIKEP HFLHAIEYGN- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Dual roles of Sema6D in cardiac morphogenesis through region-specific association of its receptor, Plexin-A1, with off-track and vascular endothelial growth factor receptor type 2.
Toyofuku T, Zhang H, Kumanogoh A, Takegahara N, Suto F, Kamei J, Aoki K, Yabuki M, Hori M, Fujisawa H, Kikutani H
Genes & development 2004 Feb 15;18(4):435-47
Genes & development 2004 Feb 15;18(4):435-47
No comments: Submit comment
No validations: Submit validation data