HPA017074

PTGFRN antibody from Sigma-Aldrich
CD315, CD9P-1, EWI-F, FLJ11001, FPRP, KIAA1436, SMAP-6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017074
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017074, RRID:AB_1855888
Product name
Anti-PTGFRN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017074
Antibody type
Polyclonal
Antigen
Prostaglandin F2 receptor negative regulator precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSGYYYCHVSLWAPGHNRSWHKVAEAVSSPAGVGV
TWLEPDYQVYLNASKVPGFADDPTELACRVVDTKS
GEANVRFTVSWYYRMNRRSDNVVTSELLAVMDGDW
Storage
-20C
Provider Type Product Number
- No reagents -