HPA017074

PTGFRN antibody from Atlas Antibodies
CD315, CD9P-1, EWI-F, FLJ11001, FPRP, KIAA1436, SMAP-6
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017074
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017074, RRID:AB_1855888
Product name
Anti-PTGFRN
Provider product page
Atlas Antibodies - HPA017074
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NSGYYYCHVSLWAPGHNRSWHKVAEAVSSPAGVGV
TWLEPDYQVYLNASKVPGFADDPTELACRVVDTKS
GEANVRFTVSWYYRMNRRSDNVVTSELLAVMDGDW
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -