Antibody data

Product number
H00001393-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001393-M01, RRID:AB_1671568
Product name
CRHBP monoclonal antibody (M01), clone 3D9
Provider product page
Abnova Corporation - H00001393-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CRHBP.
Antigen sequence
MSPNFKLQCHFILIFLTALRGESRYLELREAADYD
PFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQF
TFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQ
GGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDF
CESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIK
TDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSII
YPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE
LLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNT
VVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIG
EFCLSGL
Isotype
IgG
Antibody clone number
3D9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -