HPA010558

IL6ST antibody from Atlas Antibodies
CD130, GP130, sGP130
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010558
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010558, RRID:AB_1078439
Product name
Anti-IL6ST
Provider product page
Atlas Antibodies - HPA010558
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTV
RTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRT
IIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAY
TDEGGKDGPEFTFTTPKFAQGEI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -