HPA010558

IL6ST antibody from Sigma-Aldrich
CD130, GP130
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010558
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010558, RRID:AB_1078439
Product name
Anti-IL6ST antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010558
Antibody type
Polyclonal
Antigen
Interleukin-6 receptor subunit beta precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTV
RTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRT
IIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAY
TDEGGKDGPEFTFTTPKFAQGEI
Storage
-20C
Provider Type Product Number
- No reagents -