Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010434-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010434-M05, RRID:AB_1112377
- Product name
- LYPLA1 monoclonal antibody (M05), clone 3D5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LYPLA1.
- Antigen sequence
NVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALI
DQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQK
LAGVTALSCWLPLRAS- Isotype
- IgG
- Antibody clone number
- 3D5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Thioesterase activity and subcellular localization of acylprotein thioesterase 1/lysophospholipase 1.
Hirano T, Kishi M, Sugimoto H, Taguchi R, Obinata H, Ohshima N, Tatei K, Izumi T
Biochimica et biophysica acta 2009 Aug;1791(8):797-805
Biochimica et biophysica acta 2009 Aug;1791(8):797-805
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of LYPLA1 expression in transfected 293T cell line by LYPLA1 monoclonal antibody (M05), clone 3D5.Lane 1: LYPLA1 transfected lysate(24.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged LYPLA1 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to LYPLA1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol