HPA001221

DGCR14 antibody from Atlas Antibodies
DGCR13, DGS-H, DGSI, ES2, Es2el
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001221
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001221, RRID:AB_611430
Product name
Anti-DGCR14
Provider product page
Atlas Antibodies - HPA001221
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ASASSLLLPAASRPPRKREAGEAGAATSKQRVLDE
EEYIEGLQTVIQRDFFPDVEKLQAQKEYLEAEENG
DLERMRQIAIKFGSALGKMSREPPPPYVTPATFET
PEVHAGTGVVGNKPRPRGRGLEDGEAGEEEEKEPL
PSLDV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -