PAB28398

ESS2 antibody from Abnova Corporation
bis1, DGCR13, DGCR14, DGS-H, DGSI, ES2, Es2el, ESS-2

Antibody data

Product number
PAB28398
Provider
Abnova Corporation
Product name
DGCR14 polyclonal antibody
Provider product page
Abnova Corporation - PAB28398
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant DGCR14.
Antigen sequence
LRVEGSETPYVDRTPGPAFKILEPGRRERLGLKMA
NEAAAKNRAKKQEALRRVTENLASLTPKGLSPAMS
PALQRLVSRTASKYTDRALRASYTPSPARSTHLKT
PASGLQTPTSTPAPGSATRTPLTQDPASITDNL
Isotype
IgG
Storage
Store at 4 °C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -