PAB28398
antibody from Abnova Corporation
Targeting: ESS2
bis1, DGCR13, DGCR14, DGS-H, DGSI, ES2, Es2el, ESS-2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28398 - Provider product page

- Provider
- Abnova Corporation
- Product name
- DGCR14 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant DGCR14.
- Antigen sequence
LRVEGSETPYVDRTPGPAFKILEPGRRERLGLKMA
NEAAAKNRAKKQEALRRVTENLASLTPKGLSPAMS
PALQRLVSRTASKYTDRALRASYTPSPARSTHLKT
PASGLQTPTSTPAPGSATRTPLTQDPASITDNL- Isotype
- IgG
- Storage
- Store at 4 °C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of lane 1: RT-4, lane 2: U-251 MG, lane 3: A-431, and lane 4: Liver using DGCR14 polyclonal antibody (Cat # PAB28398).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of lane 1: NIH-3T3, lane 2: NBT-II, and lane 3: PC12 cell lysates using DGCR14 polyclonal antibody (Cat # PAB28398).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human prostate with DGCR14 polyclonal antibody (Cat # PAB28398) shows strong nuclear positivity in glandular cells.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)