HPA001222

ESS2 antibody from Atlas Antibodies
bis1, DGCR13, DGCR14, DGS-H, DGSI, ES2, Es2el, ESS-2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001222
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001222, RRID:AB_1078647
Product name
Anti-DGCR14
Provider product page
Atlas Antibodies - HPA001222
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LRVEGSETPYVDRTPGPAFKILEPGRRERLGLKMA
NEAAAKNRAKKQEALRRVTENLASLTPKGLSPAMS
PALQRLVSRTASKYTDRALRASYTPSPARSTHLKT
PASGLQTPTSTPAPGSATRTPLTQDPASITDNL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -