HPA001222

ESS2 antibody from MilliporeSigma / Merck KGaA
bis1, DGCR13, DGCR14, DGS-H, DGSI, ES2, Es2el, ESS-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001222
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-DGCR14 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA001222
Antibody type
Polyclonal
Antigen
Protein DGCR14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRVEGSETPYVDRTPGPAFKILEPGRRERLGLKMA
NEAAAKNRAKKQEALRRVTENLASLTPKGLSPAMS
PALQRLVSRTASKYTDRALRASYTPSPARSTHLKT
PASGLQTPTSTPAPGSATRTPLTQDPASITDNL
Storage
-20C