HPA035578

CDYL antibody from Atlas Antibodies
CDYL1, DKFZP586C1622

Antibody data

Product number
HPA035578
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA035578, RRID:AB_2674685
Product name
Anti-CDYL
Provider product page
Atlas Antibodies - HPA035578
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PVKSRTAVDGFQSESPEKLDPVEQGQEDTVAPEVA
AEKPVGALLGPGAERARMGSRPRIHP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.