Antibody data

Product number
H00009425-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009425-M02, RRID:AB_1237671
Product name
CDYL monoclonal antibody (M02), clone 1A6
Provider product page
Abnova Corporation - H00009425-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CDYL.
Antigen sequence
LVIGKDHESKNSQLFAASQKFRKNTAPSLSSRKNM
DLAKSGIKILVPKSPVKSRTAVDGFQSESPEKLDP
VEQGQEDTVAPEVAAEKPVGALLGPGAERARMGSR
PRI
Isotype
IgG
Antibody clone number
1A6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -