Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN785418 - Provider product page 
- Provider
- antibodies-online
- Product name
- anti-Chromodomain Protein, Y-Like (CDYL) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CDYL antibody: synthetic peptide directed towards the n terminal of human CDYL
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
- YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISR
 STNSN FSKTSPKALV
- Vial size
- 50 µg
Submitted references		A strategy to rapidly identify the functional targets of microRNAs by combining bioinformatics and mRNA cytoplasmic/nucleic ratios in culture cells.
				
Phosphoproteome analysis of the human mitotic spindle.
				
		
	
			Li J, Xia W, Huang B, Chen L, Su X, Li S, Wang F, Ding H, Shao N
FEBS letters 2010 Jul 16;584(14):3198-202
		FEBS letters 2010 Jul 16;584(14):3198-202
Phosphoproteome analysis of the human mitotic spindle.
			Nousiainen M, Silljé HH, Sauer G, Nigg EA, Körner R
Proceedings of the National Academy of Sciences of the United States of America 2006 Apr 4;103(14):5391-6
		Proceedings of the National Academy of Sciences of the United States of America 2006 Apr 4;103(14):5391-6
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
		- Submitted by
- antibodies-online (provider)
- Main image
 
- Experimental details
- Sample Type: HeLa Primary Antibody Dilution: 4 μg/mL Secondary Antibody: Anti-rabbit Alexa 546 Secondary Antibody Dilution: μg/mL Gene Name: CDYL
- Submitted by
- antibodies-online (provider)
- Main image
 
- Experimental details
- Sample Type: MD MB231 Primary Antibody Dilution: 4 μg/mL Secondary Antibody: Anti-rabbit Alexa 546 Secondary Antibody Dilution: μg/mL Gene Name: CDYL