Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502348 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-F-Box and Leucine-Rich Repeat Protein 3 (FBXL3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FBXL3 antibody: synthetic peptide directed towards the middle region of human FBXL3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LISTARPSFMDLPKSHFISALTVVFVNSKSLSSLK
IDDTP VDDPSLKVLV- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references SCFFbxl3 controls the oscillation of the circadian clock by directing the degradation of cryptochrome proteins.
Busino L, Bassermann F, Maiolica A, Lee C, Nolan PM, Godinho SI, Draetta GF, Pagano M
Science (New York, N.Y.) 2007 May 11;316(5826):900-4
Science (New York, N.Y.) 2007 May 11;316(5826):900-4
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting