H00008563-B01

THOC5 antibody from Abnova Corporation
C22orf19, Fmip, fSAP79, KIAA0983, PK1.3

Antibody data

Product number
H00008563-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008563-B01, RRID:AB_1572738
Product name
C22orf19 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00008563-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C22orf19 protein.
Antigen sequence
MSSESSKKRKPKVIRSDGAPAEGKRNRSDTEQEGK
YYSEEAEVDLRDPGRDYELYKYTCQELQRLMAEIQ
DLKSRGGKDVAIEIEERRIQSCVHFMTLKKLNRLA
HIRLKKGRDQTHEAKQKVDAYHLQLQNLLYEVMHL
QKEITKCLEFKSKHEEIDLVSLEEFYKEAPPDISK
AEVTMGDPHQQTLARLDWELEQRKRLAEKYRECLS
NKEKILKEIEVKKEYLSSLQPRLNSIMQASLPVQE
YLFMPFDQAHKQYETARHLPPPLYVLFVQATAYGQ
ACDKTLSVAIEGSVDEAKALFKPPEDSQDDESDSD
AEEEQTTKRRRPTLGVQLDDKRKEMLKRHPLSVML
DLKCKDDSVLHLTFYYLMNLNIMTVKAKVTTAMEL
ITPISAGDLLSPDSVLSCLYPGDHGKKTPNPANQY
QFDKVGILTLSDYVLELGHPYLWVQKLGGLHFPKE
QPQQTVIADHSLSASHMETTMKLLKTRVQSRLALH
KQFASLEHGIVPVTSDCQYLFPAKVVSRLVKWVTI
AHEDYMELHFTKDIVDAGLAGDTNLYYMALIERGT
AKLQAAVVLNPGYSSIPPIFQLCLNWKGEKTNSND
DNIRAMEGEVNVCYKELCGPWPSHQLLTNQLQRLC
VLLDVYLETESHDDSVEGPKEFPQEKMCLRLFRGP
SRMKPFKYNHPQGFFSHR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -