HPA012611

THSD1 antibody from Sigma-Aldrich
TMTSP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012611
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012611, RRID:AB_1857990
Product name
Anti-THSD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012611
Antibody type
Polyclonal
Antigen
Thrombospondin type-1 domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLK
EMKKKGLTETTKVYHVSQSPLTDTAIDAAPSAPLD
LESPEEAAANKFRIKSPFPEQPAVSAGERPPSRLD
LNVTQ
Storage
-20C
Provider Type Product Number
- No reagents -