HPA055312

SAT1 antibody from Atlas Antibodies
SAT, SSAT

Antibody data

Product number
HPA055312
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA055312, RRID:AB_2682781
Product name
Anti-SAT1
Provider product page
Atlas Antibodies - HPA055312
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYH
CLV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.