ABIN635812

antibody from antibodies-online

Targeting: GALNT5 GalNAc-T5

Western blot

Antibody data

Submit

Validation data

Product number: ABIN635812 - Provider product page
Provider: antibodies-online
Product name: anti-UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 5 (GalNAc-T5) (GALNT5) antibody
Antibody type: Polyclonal
Antigen: GALNT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDRMKTVERNLVRVAE
Description: Affinity purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

GALNT5 protein structure - ABIN635812 shown in red.