HPA009035

GALNT5 antibody from Atlas Antibodies
GalNAc-T5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009035
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009035, RRID:AB_1078943
Product name
Anti-GALNT5
Provider product page
Atlas Antibodies - HPA009035
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MKPPLRGHGKGAWGKENVRKTEESVLKVEVDLDQT
QRERKMQNALGRGKVVPLWHPAHLQTLPVTPNKQK
TDGRGTKPEASSHQGTPKQTTAQGAPKTSFIAAKG
TQVVKISVHMGRVSLKQEPR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -