HPA009035

GALNT5 antibody from Sigma-Aldrich
GalNAc-T5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009035
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009035, RRID:AB_1078943
Product name
Anti-GALNT5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009035
Antibody type
Polyclonal
Antigen
Polypeptide N-acetylgalactosaminyltransferase 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MKPPLRGHGKGAWGKENVRKTEESVLKVEVDLDQT
QRERKMQNALGRGKVVPLWHPAHLQTLPVTPNKQK
TDGRGTKPEASSHQGTPKQTTAQGAPKTSFIAAKG
TQVVKISVHMGRVSLKQEPR
Storage
-20C
Provider Type Product Number
- No reagents -