H00057325-B01

KAT14 antibody from Abnova Corporation
ATAC2, CRP2BP, CSRP2BP, dJ717M23.1, PRO1194

Antibody data

Product number
H00057325-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057325-B01, RRID:AB_1204227
Product name
CSRP2BP MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00057325-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CSRP2BP protein.
Antigen sequence
MDSSIHLSSLISRHDDEATRTSTSEGLEEGEVEGE
TLLIVESEDQASVDLSHDQSGDSLNSDEGDVSWME
EQLSYFCDKCQKWIPASQLREQLSYLKGDNFFRFT
CSDCSADGKEQYERLKLTWQQVVMLAMYNLSLEGS
GRQGYFRWKEDICAFIEKHWTFLLGNRKKTSTWWS
TVAGCLSVGSPMYFRSGAQEFGEPGWWKLVHNKPP
TMKPEGEKLSASTLKIKAASKPTLDPIITVEGLRK
RASRNPVESAMELKEKRSRTQEAKDIRRAQKEAAG
FLDRSTSSTPVKFISRGRRPDVILEKGEVIDFSSL
SSSDRTPLTSPSPSPSLDFSAPGTPASHSATPSLL
SEADLIPDVMPPQALFHDDDEMEGDGVIDPGMEYV
PPPAGSVASGPVVGGRKKVRGPEQIKQEVESEEEK
PDRMDIDSEDTDSNTSLQTRAREKRKPQLEKDTKP
KEPRYTPVSIYEEKLLLKRLEACPGAVAMTPEARR
LKRKLIVRQAKRDRGLPLFDLDQVVNAALLLVDGI
YGAKEGGISRLPAGQATYRTTCQDFRILDRYQTSL
PSRKGFRHQTTKFLYRLVGSEDMAVDQSIVSPYTS
RILKPYIRRDYETKPPKLQLLSQIRSHLHRSDPHW
TPEPDAPLDYCYVRPNHIPTINSMCQEFFWPGIDL
SECLQYPDFSVVVLYKKVIIAFGFMVPDVKYNEAY
ISFLFVHPEWRRAGIATFMIYHLIQTCMGKDVTLH
VSASNPAMLLYQKFGFKTEEYVLDFYDKYYPLEST
ECKHAFFLRLRR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -