H00010799-B01P

RPP40 antibody from Abnova Corporation
bA428J1.3, RNASEP1

Antibody data

Product number
H00010799-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010799-B01P, RRID:AB_1580271
Product name
RPP40 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00010799-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human RPP40 protein.
Antigen sequence
MNTGPYYFVKNLPLHELITPEFISTFIKKGKLILS
LDKDTYEETGLQGHPSQFSGRKIMKFIVSIDLMEL
SLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGS
EESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQ
SSELEGTPEVSCRALELFDWLGAVFSNVDLNNEPN
NFISTYCCPEPSTVVAKAYLCTITGFILPEKICLL
LEHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -