Antibody data

Product number
H00008508-M15
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008508-M15, RRID:AB_1578050
Product name
NIPSNAP1 monoclonal antibody (M15), clone 3B7
Provider product page
Abnova Corporation - H00008508-M15
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NIPSNAP1.
Antigen sequence
YELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVG
GFFSQIGELYVVHHLWAYKDLQSREETRNAAWRKR
GWDENVYYTVPLVRHMESRIMIPLKISPLQ
Isotype
IgG
Antibody clone number
3B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -