HPA015127

UGGT1 antibody from Sigma-Aldrich
HUGT1, UGCGL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015127
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015127, RRID:AB_1858596
Product name
Anti-UGCGL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015127
Antibody type
Polyclonal
Antigen
UDP-glucose:glycoprotein glucosyltransferase 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVKVEHVVSVLEKKYPYVEVNSILGIDSAYDRNRK
EARGYYEQTGVGPLPVVLFNGMPFEREQLDPDELE
TITMHKILETTTFFQRAVYLGELPHDQDVVEYIMN
QPNVVPRINSRILTAERDYLDLTASNNFFVDDYA
Storage
-20C
Provider Type Product Number
- No reagents -