HPA015127

UGGT1 antibody from Atlas Antibodies
HUGT1, UGCGL1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015127
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015127, RRID:AB_1858596
Product name
Anti-UGGT1
Provider product page
Atlas Antibodies - HPA015127
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KVKVEHVVSVLEKKYPYVEVNSILGIDSAYDRNRK
EARGYYEQTGVGPLPVVLFNGMPFEREQLDPDELE
TITMHKILETTTFFQRAVYLGELPHDQDVVEYIMN
QPNVVPRINSRILTAERDYLDLTASNNFFVDDYA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -