HPA008965

GYPC antibody from Atlas Antibodies
CD236, CD236R, Ge, GPC, GYPD
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008965
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008965, RRID:AB_888444
Product name
Anti-GYPC
Provider product page
Atlas Antibodies - HPA008965
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQ
DAGDSSRKEYFI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -