H00005373-M02

PMM2 antibody from Abnova Corporation
CDG1, CDG1a, CDGS, PMI, PMI1

Antibody data

Product number
H00005373-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005373-M02, RRID:AB_1578915
Product name
PMM2 monoclonal antibody (M02), clone 2A5
Provider product page
Abnova Corporation - H00005373-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PMM2.
Antigen sequence
MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKL
RQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPE
NGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLS
YIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEE
RIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIG
GQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDK
TMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLF
S
Isotype
IgG
Antibody clone number
2A5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -