HPA031543

CXorf58 antibody from MilliporeSigma / Merck KGaA
FLJ25444
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031543
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031543, RRID:AB_10603789
Product name
Anti-CXorf58 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031543
Antibody type
Polyclonal
Antigen
chromosome X open reading frame 58 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
THEILKKVAPLEAKLIKDPTMQCKIRFRFRGETFP
PFIVFKIFLHTDGHGYKYFSGKNVLMPSSKAVDDA
CKLMGERKFHRIIMEDER
Storage
-20C
Provider Type Product Number
- No reagents -