HPA008966

MRAP2 antibody from Sigma-Aldrich
bA51G5.2, C6orf117
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008966
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008966, RRID:AB_1078356
Product name
Anti-MRAP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008966
Antibody type
Polyclonal
Antigen
Uncharacterized protein C6orf117
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TGAPHQDNAESSEKRFRMNSFVSDFGRPLEPDKVF
SRQGNEESRSLFHCYINEVERLDRAKACHQTTALD
SDVQLQEAIRSSGQPEEELNRLMKFDIPNFVNTDQ
NYFGEDDLLISEPPIVLETKPLSQTSHK
Storage
-20C
Provider Type Product Number
- No reagents -