Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AV49115 - Provider product page

- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Anti-PAPD4 antibody produced in rabbit
- Antibody type
- Polyclonal
- Antigen
- synthetic peptide corresponding to a region of human PAPD4 with an internal ID of Y02312
- Description
- affinity isolated antibody
- Reactivity
- Human
- Antigen sequence
FRGRKRLSDEKNLPLDGKRQRFHSPHQEPTVVNQI
VPLSGERRYSMPPLF- Storage
- -20C
Submitted references A comprehensive survey of 3' animal miRNA modification events and a possible role for 3' adenylation in modulating miRNA targeting effectiveness.
Burroughs AM, Ando Y, de Hoon MJ, Tomaru Y, Nishibu T, Ukekawa R, Funakoshi T, Kurokawa T, Suzuki H, Hayashizaki Y, Daub CO
Genome research 2010 Oct;20(10):1398-410
Genome research 2010 Oct;20(10):1398-410
No comments: Submit comment
No validations: Submit validation data