HPA024566

PRRG4 antibody from Sigma-Aldrich
TMG4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024566
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024566, RRID:AB_2237712
Product name
Anti-PRRG4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024566
Antibody type
Polyclonal
Antigen
Transmembrane gamma-carboxyglutamic acid protein 4 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ARGPKASKHAGEEVFTSKEEANFFIHRRLLYNRFD
LELFTPGNLERECNEELCNYEEAREIFVDEDKTIA
FWQEYSAKGPTTKSDGNR
Storage
-20C
Provider Type Product Number
- No reagents -